GSTM1, Mouse, Clone: 3B10, Abnova™

Catalog No.	Quantity
89-022-404	100 μg

Catalog No. 89-022-404 Supplier Abnova Corporation Supplier No. H00002944M01

Description

Mouse monoclonal antibody raised against a partial recombinant GSTM1.

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene. [provided by RefSeq]

Sequence: MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDIL

Specifications

• Antigen: GSTM1
• Applications: ELISA
• Classification: Monoclonal
• Clone: 3B10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GSTM1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GSTM1
• Gene Accession No.: BC024005
• Gene Alias: GST1/GSTM1-1/GSTM1a-1a/GSTM1b-1b/GTH4/GTM1/H-B/MGC26563/MU/MU-1
• Gene Symbols: GSTM1
• Host Species: Mouse
• Immunogen: GSTM1 (AAH24005, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2944
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ