Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GSTO1, Mouse, Clone: 1B6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant GSTO1.

Manufacturer:  Abnova Corporation H00009446M03

Catalog No. 89-002-746


Add to cart

Description

Description

This gene encodes a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis. [provided by RefSeq

Sequence: SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKED
Specifications

Specifications

GSTO1,
1B6
Mouse monoclonal antibody raised against a partial recombinant GSTO1.
GSTO1
Liquid
GSTO1
GSTO1 (NP_004823, 121 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA, Western Blot
Unconjugated
In 1X PBS, pH 7.4
NM_004832
DKFZp686H13163|GSTTLp28|P28
Mouse
IgG1 Kappa
RUO
Primary
9446
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit