Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89003207

GSTO2, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89003207 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-003-207 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-003-207 Supplier Abnova Corporation Supplier No. H00119391D01P
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against a full-length human GSTO2 protein.

The omega class glutathione transferases (GST; EC 2.5.1.18) have poor activity with common GST substrates, but exhibit novel glutathione-dependent thioltransferase, dehydroascorbate reductase, and monomethylarsonate reductase activities, and they modulate Ca(2+) release by ryanodine receptors (e.g., RYR1, MIM 180901) (Whitbread et al., 2003 [PubMed 12618591]). For background information on GSTs, see MIM 605482.[supplied by OMIM

Sequence: MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC

Specifications

Antigen GSTO2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against a full-length human GSTO2 protein.
Formulation PBS with no preservative; pH 7.4
Gene GSTO2
Gene Accession No. NM_183239.1
Gene Alias bA127L20.1
Gene Symbols GSTO2
Host Species Rabbit
Immunogen GSTO2 (NP_899062.1, 1 a.a. ∼ 243 a.a) full-length human protein.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 119391
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.