GSTP1, Mouse, Clone: 3E6-H2, Abnova™

Catalog No.	Quantity
89-022-409	100 μg

Catalog No. 89-022-409 Supplier Abnova Corporation Supplier No. H00002950M03

Description

Mouse monoclonal antibody raised against a full-length recombinant GSTP1.

Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. [provided by RefSeq

Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPEFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Specifications

• Antigen: GSTP1
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 3E6-H2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant GSTP1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GSTP1
• Gene Accession No.: BC010915
• Gene Alias: DFN7/FAEES3/GST3/PI
• Gene Symbols: GSTP1
• Host Species: Mouse
• Immunogen: GSTP1 (AAH10915, 1 a.a. ∼ 210 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2950
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ