GSTT1, Mouse, Clone: 2E10-1B2, Abnova™

Catalog No.	Quantity
89-022-410	100 μg

Catalog No. 89-022-410 Supplier Abnova Corporation Supplier No. H00002952M01

Description

Mouse monoclonal antibody raised against a full-length recombinant GSTT1.

Glutathione S-transferase (GST) theta 1 (GSTT1) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1 and GSTT2. The GSTT1 and GSTT2 share 55% amino acid sequence identity and both of them were claimed to have an important role in human carcinogenesis. The GSTT1 gene is located approximately 50kb away from the GSTT2 gene. The GSTT1 and GSTT2 genes have a similar structure, being composed of five exons with identical exon/intron boundaries. [provided by RefSeq

Sequence: MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR

Specifications

• Antigen: GSTT1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2E10-1B2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant GSTT1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GSTT1
• Gene Accession No.: BC007065
• Gene Symbols: GSTT1
• Host Species: Mouse
• Immunogen: GSTT1 (AAH07065, 1 a.a. ∼ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2952
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ