GSTZ1, Rabbit, MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human GSTZ1 protein.

Supplier:  Abnova Corporation H00002954D01

Catalog No. 89-002-893

Description

This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia. Several transcript variants of this gene encode multiple protein isoforms. [provided by RefSeq

Sequence: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA

Specifications

• Antigen: GSTZ1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human GSTZ1 protein.
• Gene: GSTZ1
• Gene Alias: GSTZ1-1/MAAI/MAI/MGC2029
• Host Species: Rabbit
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Liquid

• Applications: Immunoprecipitation, Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_145870.1
• Gene Symbols: GSTZ1
• Immunogen: GSTZ1 (NP_665877.1, 1 a.a. ∼ 216 a.a) full-length human protein.
• Regulatory Status: RUO
• Gene ID (Entrez): 2954
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.