Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89022416

GTF2A2, Mouse, Clone: 2B9, Abnova™

Catalog No. 89022416 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-416 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-416 Supplier Abnova Corporation Supplier No. H00002958M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant GTF2A2.

Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 189968), TFIIG/TFIIJ, and TFIIH (MIM 189972). The first step involves recognition of the TATA element by the TATA-binding subunit (TBP; MIM 600075) and may be regulated by TFIIA, a factor that interacts with both TBP and a TBP-associated factor (TAF; MIM 600475) in TFIID. TFIIA has 2 subunits (43 and 12kDa) in yeast and 3 subunits in higher eukaryotes. In HeLa extracts, it consists of a 35kDa alpha subunit and a 19kDa beta subunit encoded by the N- and C-terminal regions of GTF2A1 (MIM 600520), respectively, and a 12kDa gamma subunit encoded by GTF2A2 (DeJong et al., 1995 [PubMed 7724559]).[supplied by OMIM

Sequence: MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

Specifications

Antigen GTF2A2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2B9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant GTF2A2.
Formulation PBS with no preservative; pH 7.4
Gene GTF2A2
Gene Accession No. BC000287
Gene Alias HsT18745/TF2A2/TFIIA
Gene Symbols GTF2A2
Host Species Mouse
Immunogen GTF2A2 (AAH00287, 1 a.a. ∼ 109 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2958
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.