Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89022420

GTF2H4, Mouse, Clone: 4F6, Abnova™

Catalog No. 89022420 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-420 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-420 Supplier Abnova Corporation Supplier No. H00002968M03
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant GTF2H4.

Sequence: QIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS

Specifications

Antigen GTF2H4
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4F6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GTF2H4.
Formulation PBS with no preservative; pH 7.4
Gene GTF2H4
Gene Accession No. BC004935
Gene Alias TFB2/TFIIH
Gene Symbols GTF2H4
Host Species Mouse
Immunogen GTF2H4 (AAH04935.1, 363 a.a. ∼ 462 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2968
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.