GTF3A, Mouse, Clone: 4B4, Abnova™

Catalog No.	Quantity
89-022-425	100 μg

Catalog No. 89-022-425 Supplier Abnova Corporation Supplier No. H00002971M10

Description

Mouse monoclonal antibody raised against a partial recombinant GTF3A.

The product of this gene is a zinc finger protein with nine Cis[2]-His[2] zinc finger domains. It functions as an RNA polymerase III transcription factor to induce transcription of the 5S rRNA genes. The protein binds to a 50bp internal promoter in the 5S genes called the internal control region (ICR), and nucleates formation of a stable preinitiation complex. This complex recruits the TFIIIC and TFIIIB transcription factors and RNA polymerase III to form the complete transcription complex. The protein is thought to be translated using a non-AUG translation initiation site in mammals based on sequence analysis, protein homology, and the size of the purified protein. [provided by RefSeq

Sequence: NQQKQYICSFEDCKKTFKKHQQLKIHQCQNTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVRETHKEE

Specifications

• Antigen: GTF3A
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4B4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GTF3A.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GTF3A
• Gene Accession No.: NM_002097
• Gene Alias: AP2/TFIIIA
• Gene Symbols: GTF3A
• Host Species: Mouse
• Immunogen: GTF3A (NP_002088, 185 a.a. ∼ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2971
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ