general transcription factor IIIC, polypeptide 3, 102kDa, Mouse, Clone: 3D9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant GTF3C3.

Supplier:  Abnova Corporation H00009330M02

Catalog No. 89-001-126

Description

Sequence: TPEQPTAGDVFVLEMVLNRETKKMMKEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNP

Specifications

• Antigen: general transcription factor IIIC, polypeptide 3, 102kDa
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_012086
• Gene Symbols: GTF3C3
• Immunogen: GTF3C3 (NP_036218, 112 a.a. ∼ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 9330
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ

• Applications: ELISA, KnockDown, Western Blot
• Clone: 3D9
• Description: Mouse monoclonal antibody raised against a partial recombinant GTF3C3.
• Gene: GTF3C3
• Gene Alias: TFIIIC102/TFIIICgamma/TFiiiC2-102
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody