GUCA1A, Mouse, Clone: 2F7, Abnova™

Catalog No.	Quantity
89-022-429	100 μg

Catalog No. 89-022-429 Supplier Abnova Corporation Supplier No. H00002978M04

Description

Mouse monoclonal antibody raised against a partial recombinant GUCA1A.

This gene plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1). GC1 is activated by decreasing Ca(2+) concentrations following photobleaching. The protein encoded by this gene, guanylyl cyclase activating protein 1 (GCAP1), mediates the sensitivity of GC1 to Ca(2+) concentrations. GCAP1 promotes activity of GC1 at low Ca(2+) concentrations and inhibits GC1 activity at high Ca(2+) concentrations. Mutations in this gene cause autosomal dominant cone dystrophy (COD3); a disease characterized by reduced visual acuity associated with progressive loss of color vision. Mutations in this gene prohibit the inactivation of RetGC1 at high Ca(2+) concentrations; causing the constitutive activation of RetGC1 and, presumably, increased cell death. This gene is expressed in retina and spermatagonia. [provided by RefSeq]

Sequence: MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLR

Specifications

• Antigen: GUCA1A
• Applications: ELISA, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 2F7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GUCA1A.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GUCA1A
• Gene Accession No.: NM_000409
• Gene Alias: COD3/GCAP/GCAP1/GUCA/GUCA1
• Gene Symbols: GUCA1A
• Host Species: Mouse
• Immunogen: GUCA1A (NP_000400, 1 a.a. ∼ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2978
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ