Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000702

guanylate cyclase 2C (heat stable enterotoxin receptor), Mouse, Clone: 1B11, Abnova™

Catalog No. 89000702 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-702 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-702 Supplier Abnova Corporation Supplier No. H00002984M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant GUCY2C.

Sequence: SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL

Specifications

Antigen guanylate cyclase 2C (heat stable enterotoxin receptor)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1B11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GUCY2C.
Formulation PBS with no preservative; pH 7.4
Gene GUCY2C
Gene Accession No. NM_004963.3
Gene Alias GUC2C/STAR
Gene Symbols GUCY2C
Host Species Mouse
Immunogen GUCY2C (NP_004954, 24 a.a. ∼ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 2984
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.