guanylate cyclase 2D, membrane (retina-specific), Mouse, Clone: 6D9, Abnova™

Catalog No.	Quantity
89-000-703	100 μg

Catalog No. 89-000-703 Supplier Abnova Corporation Supplier No. H00003000M02

Description

Mouse monoclonal antibody raised against a partial recombinant GUCY2D.

This gene encodes a retina-specific guanylate cyclase, which is a member of the membrane guanylyl cyclase family. Like other membrane guanylyl cyclases, this enzyme has a hydrophobic amino-terminal signal sequence followed by a large extracellular domain, a single membrane spanning domain, a kinase homology domain, and a guanylyl cyclase catalytic domain. In contrast to other membrane guanylyl cyclases, this enzyme is not activated by natriuretic peptides. Mutations in this gene result in Leber congenital amaurosis and cone-rod dystrophy-6 diseases. [provided by RefSeq

Sequence: RKVAQGSRSSLGARSMSDIRSGPSQHLDSPNIGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDL

Specifications

• Antigen: guanylate cyclase 2D, membrane (retina-specific)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 6D9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GUCY2D.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GUCY2D
• Gene Accession No.: NM_000180
• Gene Alias: CORD5/CORD6/CYGD/GUC1A4/GUC2D/LCA/LCA1/RETGC-1/ROS-GC1/retGC
• Gene Symbols: GUCY2D
• Host Species: Mouse
• Immunogen: GUCY2D (NP_000171, 521 a.a. ∼ 630 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3000
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG