Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

guanylate cyclase 2D, membrane (retina-specific), Mouse, Clone: 6D9, Abnova™

Catalog No. 89000703 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-703 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-703 Supplier Abnova Corporation Supplier No. H00003000M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant GUCY2D.

This gene encodes a retina-specific guanylate cyclase, which is a member of the membrane guanylyl cyclase family. Like other membrane guanylyl cyclases, this enzyme has a hydrophobic amino-terminal signal sequence followed by a large extracellular domain, a single membrane spanning domain, a kinase homology domain, and a guanylyl cyclase catalytic domain. In contrast to other membrane guanylyl cyclases, this enzyme is not activated by natriuretic peptides. Mutations in this gene result in Leber congenital amaurosis and cone-rod dystrophy-6 diseases. [provided by RefSeq

Sequence: RKVAQGSRSSLGARSMSDIRSGPSQHLDSPNIGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDL

Specifications

Antigen guanylate cyclase 2D, membrane (retina-specific)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 6D9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GUCY2D.
Formulation PBS with no preservative; pH 7.4
Gene GUCY2D
Gene Accession No. NM_000180
Gene Alias CORD5/CORD6/CYGD/GUC1A4/GUC2D/LCA/LCA1/RETGC-1/ROS-GC1/retGC
Gene Symbols GUCY2D
Host Species Mouse
Immunogen GUCY2D (NP_000171, 521 a.a. ∼ 630 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 3000
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.