Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89022437

GZMB, Mouse, Clone: 4F5, Abnova™

Catalog No. 89022437 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-437 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-437 Supplier Abnova Corporation Supplier No. H00003002M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant GZMB.

Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein encoded by this gene is crucial for the rapid induction of target cell apoptosis by CTL in cell-mediated immune response. [provided by RefSeq]

Sequence: GQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRH

Specifications

Antigen GZMB
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 4F5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GZMB.
Formulation PBS with no preservative; pH 7.4
Gene GZMB
Gene Accession No. BC030195
Gene Alias CCPI/CGL-1/CGL1/CSP-B/CSPB/CTLA1/CTSGL1/HLP/SECT
Gene Symbols GZMB
Host Species Mouse
Immunogen GZMB (AAH30195, 148 a.a. ∼ 247 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3002
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.