H2A histone family, member V, Mouse, Clone: 2F9, Abnova™

Catalog No.	Quantity
89-015-852	100 μg

Catalog No. 89-015-852 Supplier Abnova Corporation Supplier No. H00094239M08

Description

Mouse monoclonal antibody raised against a full-length recombinant H2AFV.

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a member of the histone H2A family. Several transcript variants encoding different isoforms, have been identified for this gene. [provided by RefSeq

Sequence: MAGGKAGRDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA

Specifications

• Antigen: H2A histone family, member V
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed)
• Classification: Monoclonal
• Clone: 2F9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant H2AFV.
• Formulation: PBS with no preservative; pH 7.4
• Gene: H2AFV
• Gene Accession No.: BC000098
• Gene Alias: FLJ26479/H2AV/MGC10170/MGC10831/MGC1947
• Gene Symbols: H2AFV
• Host Species: Mouse
• Immunogen: H2AFV (AAH00098, 1 a.a. ∼ 128 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 94239
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ