hydroxysteroid (17-beta) dehydrogenase 10, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human HSD17B10 protein.

Supplier:  Abnova Corporation H00003028B01

Catalog No. 89-005-505

Description

This gene encodes 3-hydroxyacyl-CoA dehydrogenase type II, a member of the short-chain dehydrogenase/reductase superfamily. The gene product is a mitochondrial protein that catalyzes the oxidation of a wide variety of fatty acids, alcohols, and steroids. The protein has been implicated in the development of Alzheimer's disease, and mutations in the gene are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq]

Sequence: MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

Specifications

• Antigen: hydroxysteroid (17-beta) dehydrogenase 10
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human HSD17B10 protein.
• Gene: HSD17B10
• Gene Alias: 17b-HSD10/ABAD/CAMR/DUPXp11.22/ERAB/HADH2/HCD2/MHBD/MRPP2/MRX17/MRX31/MRXS10/SCHAD/SDR5C1
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 3028
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: Immunofluorescence, Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_004493.2
• Gene Symbols: HSD17B10
• Immunogen: HSD17B10 (NP_004484.1, 1 a.a. ∼ 261 a.a) full-length human protein.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum