hydroxyacyl-Coenzyme A dehydrogenase, Mouse, Clone: 4B5, Abnova™

Catalog No.	Quantity
89-014-123	100 μg

Catalog No. 89-014-123 Supplier Abnova Corporation Supplier No. H00003033M01

Description

Mouse monoclonal antibody raised against a partial recombinant HADHSC.

This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene. [provided by RefSeq

Sequence: GKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK

Specifications

• Antigen: hydroxyacyl-Coenzyme A dehydrogenase
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 4B5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant HADHSC.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HADH
• Gene Accession No.: NM_005327
• Gene Alias: HAD/HADH1/HADHSC/HHF4/M/SCHAD/MGC8392/SCHAD
• Gene Symbols: HADH
• Host Species: Mouse
• Immunogen: HADHSC (NP_005318, 205 a.a. ∼ 314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3033
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ