Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HAL, Mouse, Clone: 4F2, Abnova™

Catalog No. 89022443 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-443 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-443 Supplier Abnova Corporation Supplier No. H00003034M04
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant HAL.

Histidine ammonia-lyase is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. Histidine ammonia-lyase defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids [provided by RefSeq

Sequence: LAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIEAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTKIPESEDL*

Specifications

Antigen HAL
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 4F2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant HAL.
Formulation PBS with no preservative; pH 7.4
Gene HAL
Gene Accession No. NM_002108
Gene Alias HIS/HSTD
Gene Symbols HAL
Host Species Mouse
Immunogen HAL (NP_002099, 558 a.a. ∼ 657 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3034
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.