heart and neural crest derivatives expressed 2, Mouse, Clone: 3E3, Abnova™

Catalog No.	Quantity
89-001-137	100 μg

Catalog No. 89-001-137 Supplier Abnova Corporation Supplier No. H00009464M03

Description

Mouse monoclonal antibody raised against a partial recombinant HAND2.

The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, this transcription factor plays an important role in limb and branchial arch development. [provided by RefSeq

Sequence: LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELK

Specifications

• Antigen: heart and neural crest derivatives expressed 2
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 3E3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant HAND2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HAND2
• Gene Accession No.: NM_021973
• Gene Alias: DHAND2/FLJ16260/Hed/MGC125303/MGC125304/Thing2/bHLHa26/dHand
• Gene Symbols: HAND2
• Host Species: Mouse
• Immunogen: HAND2 (NP_068808.1, 135 a.a. ∼ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Angiogenesis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 9464
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ