heart and neural crest derivatives expressed 2, Mouse, Clone: 3E3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant HAND2.

Supplier:  Abnova Corporation H00009464M03

Catalog No. 89-001-137

Description

The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, this transcription factor plays an important role in limb and branchial arch development. [provided by RefSeq

Sequence: LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELK

Specifications

• Antigen: heart and neural crest derivatives expressed 2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_021973
• Gene Symbols: HAND2
• Immunogen: HAND2 (NP_068808.1, 135 a.a. ∼ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Angiogenesis
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 3E3
• Description: Mouse monoclonal antibody raised against a partial recombinant HAND2.
• Gene: HAND2
• Gene Alias: DHAND2/FLJ16260/Hed/MGC125303/MGC125304/Thing2/bHLHa26/dHand
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 9464
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ