HARS (M03), Mouse anti-Human, Clone: 4D4, Abnova™

Catalog No.	Quantity
89-022-444	50 μg

Catalog No. 89-022-444 Supplier Abnova Corporation Supplier No. H00003035M03

Description

Mouse monoclonal antibody raised against a partial recombinant HARS.

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a cytoplasmic enzyme which belongs to the class II family of aminoacyl-tRNA synthetases. The enzyme is responsible for the synthesis of histidyl-transfer RNA, which is essential for the incorporation of histidine into proteins. The gene is located in a head-to-head orientation with HARSL on chromosome five, where the homologous genes share a bidirectional promoter. The gene product is a frequent target of autoantibodies in the human autoimmune disease polymyositis/dermatomyositis. [provided by RefSeq

Sequence: MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPV

Specifications

• Antigen: HARS
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4D4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant HARS.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HARS
• Gene Accession No.: NM_002109
• Gene Alias: FLJ20491/HRS
• Gene Symbols: HARS
• Host Species: Mouse
• Immunogen: HARS (NP_002100, 1 a.a. ∼ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3035
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ