HCK, Mouse, Clone: 2A6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant HCK.

Supplier:  Abnova Corporation H00003055M02

Catalog No. 89-022-450

Description

The protein encoded by this gene is a protein-tyrosine kinase that is predominantly expressed in hemopoietic cell types. The encoded protein may help couple the Fc receptor to the activation of the respiratory burst. In addition, it may play a role in neutrophil migration and in the degranulation of neutrophils. Alternate translation initiation site usage, including a non-AUG (CUG) codon, results in the production of two different isoforms, that have different subcellular localization. [provided by RefSeq

Sequence: MGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQK

Specifications

• Antigen: HCK
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC014435
• Gene Symbols: HCK
• Immunogen: HCK (AAH14435, 1 a.a. ∼ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, In situ PLA, Western Blot
• Clone: 2A6
• Description: Mouse monoclonal antibody raised against a partial recombinant HCK.
• Gene: HCK
• Gene Alias: JTK9
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 3055
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid