Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HDAC1, Mouse, Clone: 5C4, Abnova™

Catalog No. 89022468 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-468 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-468 Supplier Abnova Corporation Supplier No. H00003065M05A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant HDAC1.

Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis. [provided by RefSeq

Sequence: MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA

Specifications

Antigen HDAC1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 5C4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant HDAC1.
Formulation ascites with no preservative
Gene HDAC1
Gene Accession No. BC000301
Gene Alias DKFZp686H12203/GON-10/HD1/RPD3/RPD3L1
Gene Symbols HDAC1
Host Species Mouse
Immunogen HDAC1 (AAH00301, 1 a.a. ∼ 482 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3065
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.