heme binding protein 1, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human HEBP1 protein.

Manufacturer: Abnova Corporation H00050865B02P

Catalog No. 89-017-073

  Check Availability
Add to Cart

    Specifications

    Antigen heme binding protein 1
    Applications Western Blotting
    Conjugate Unlabeled
    Cross Reactivity Human
    Description heme binding protein 1
    Format Affinity Purified
    Formulation In 1X PBS, pH 7.4
    Gene HEBP1
    Gene Accession No. NM_015987.3
    Gene Alias HBP, HEBP
    Gene Symbols HEBP1
    Host Species Mouse
    Immunogen HEBP1 (AAH16277.1, 1 a.a. ∽189 a.a) full-length human protein.
    Purification Method Protein A column
    Quantity 50μg
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Polyclonal
    Gene ID (Entrez) 50865

    The full-length protein encoded by this gene is an intracellular tetrapyrrole-binding protein. This protein includes a natural chemoattractant peptide of 21 amino acids at the N-terminus, which is a natural ligand for formyl peptide receptor-like receptor 2 (FPRL2) and promotes calcium mobilization and chemotaxis in monocytes and dendritic cells. [provided by RefSeq

    Sequence: MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit