Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HERC5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP158102
Description
HERC5 Polyclonal specifically detects HERC5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| HERC5 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CEB1E3 ISG15--protein ligase HERC5, CEBP1, cyclin-E binding protein 1, Cyclin-E-binding protein 1, EC 6.3.2, EC 6.3.2.-, HECT domain and RCC1-like domain-containing protein 5, hect domain and RLD 5, HECT E3 ubiquitin ligase, probable E3 ubiquitin-protein ligase HERC5 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Rabbit: 85%; Bovine: 78%; Equine: 78%. | |
| Human, Rat, Pig, Bovine, Equine, Rabbit | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin | |
| Q69G20 | |
| HERC5 | |
| Synthetic peptides corresponding to HERC5(hect domain and RLD 5) The peptide sequence was selected from the middle region of HERC5. Peptide sequence FHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTL. | |
| 100 μL | |
| Cell Cycle and Replication | |
| 51191 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction