Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000735

hairy and enhancer of split 1, (Drosophila), Mouse, Clone: 3A3, Abnova™

Catalog No. 89000735 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-735 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-735 Supplier Abnova Corporation Supplier No. H00003280M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant HES1.

This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq

Sequence: KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH

Specifications

Antigen hairy and enhancer of split 1, (Drosophila)
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 3A3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant HES1.
Formulation PBS with no preservative; pH 7.4
Gene HES1
Gene Accession No. NM_005524
Gene Alias FLJ20408/HES-1/HHL/HRY/bHLHb39
Gene Symbols HES1
Host Species Mouse
Immunogen HES1 (NP_005515, 36 a.a. ∼ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 3280
Target Species Human, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.