Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001417

hairy and enhancer of split 5 (Drosophila), Mouse, Clone: 3C5, Abnova™

Catalog No. 89001417 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-417 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-417 Supplier Abnova Corporation Supplier No. H00388585M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant HES5.

This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. [provided by RefSeq

Sequence: RRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR

Specifications

Antigen hairy and enhancer of split 5 (Drosophila)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3C5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant HES5.
Formulation PBS with no preservative; pH 7.4
Gene HES5
Gene Accession No. NM_001010926
Gene Alias bHLHb38
Gene Symbols HES5
Host Species Mouse
Immunogen HES5 (NP_001010926, 28 a.a. ∼ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 388585
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.