Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

hairy/enhancer-of-split related with YRPW motif 1, Mouse, Clone: 2F10, Abnova™

Catalog No. 89001230 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-230 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-230 Supplier Abnova Corporation Supplier No. H00023462M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant HEY1.

This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG

Specifications

Antigen hairy/enhancer-of-split related with YRPW motif 1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2F10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant HEY1.
Formulation PBS with no preservative; pH 7.4
Gene HEY1
Gene Accession No. NM_012258
Gene Alias BHLHb31/CHF2/HERP2/HESR1/HRT-1/MGC1274/OAF1
Gene Symbols HEY1
Host Species Mouse
Immunogen HEY1 (NP_036390, 121 a.a. ∼ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Neurobiology
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 23462
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.