Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HEY1, Mouse, Clone: 3E5, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant HEY1.

Manufacturer:  Abnova Corporation H00023462M13

Catalog No. 89-002-603


Add to cart

Description

Description

This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: GTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSFGPVLPVVTSASKLSLPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAA
Specifications

Specifications

HEY1
3E5
Mouse monoclonal antibody raised against a full length recombinant HEY1.
HEY1
Liquid
HEY1
HEY1 (NP_036390, 181 a.a. ~ 288 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA, Western Blot
Unconjugated
In 1X PBS, pH 7.4
NM_012258
BHLHb31|CHF2|HERP2|HESR1|HRT-1|MGC1274|OAF1
Mouse
IgG2b Kappa
RUO
Primary
23462
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit