HFE, Mouse, Clone: 1G12, Abnova™

Catalog No.	Quantity
89-022-471	100 μg

Catalog No. 89-022-471 Supplier Abnova Corporation Supplier No. H00003077M01

Description

Mouse monoclonal antibody raised against a partial recombinant HFE.

The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined. [provided by RefSeq

Sequence: SHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQ

Specifications

• Antigen: HFE
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1G12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant HFE.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HFE
• Gene Accession No.: NM_000410
• Gene Alias: HFE1/HH/HLA-H/MGC103790/dJ221C16.10.1
• Gene Symbols: HFE
• Host Species: Mouse
• Immunogen: HFE (NP_000401, 115 a.a. ∼ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3077
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ