hemochromatosis type 2 (juvenile), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-800	50 μL

Catalog No. 89-004-800 Supplier Abnova Corporation Supplier No. H00148738A01

Description

Mouse polyclonal antibody raised against a partial recombinant HFE2.

The product of this gene is involved in iron metabolism. It may be a component of the signaling pathway which activates hepcidin or it may act as a modulator of hepcidin expression. It could also represent the cellular receptor for hepcidin. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Defects in this gene are the cause of hemochromatosis type 2A, also called juvenile hemochromatosis (JH). JH is an early-onset autosomal recessive disorder due to severe iron overload resulting in hypogonadotrophic hypogonadism, hepatic fibrosis or cirrhosis and cardiomyopathy, occurring typically before age of 30. [provided by RefSeq

Sequence: GGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPS

Specifications

• Antigen: hemochromatosis type 2 (juvenile)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HFE2.
• Formulation: 50% glycerol
• Gene: HFE2
• Gene Accession No.: NM_202004
• Gene Alias: HFE2A/HJV/JH/MGC23953/RGMC
• Gene Symbols: HFE2
• Host Species: Mouse
• Immunogen: HFE2 (NP_973733, 93 a.a. ∼ 173 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 148738
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum