hepatocyte growth factor-regulated tyrosine kinase substrate, Mouse, Clone: 6D11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant HGS.

Supplier:  Abnova Corporation H00009146M01

Catalog No. 89-014-234

Description

Sequence: KLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQP

Specifications

• Antigen: hepatocyte growth factor-regulated tyrosine kinase substrate
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC003565
• Gene Symbols: HGS
• Immunogen: HGS (AAH03565, 513 a.a. ∼ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Cell Cycle
• Gene ID (Entrez): 9146
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ

• Applications: ELISA, Immunofluorescence, KnockDown, Western Blot
• Clone: 6D11
• Description: Mouse monoclonal antibody raised against a partial recombinant HGS.
• Gene: HGS
• Gene Alias: HRS/ZFYVE8
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody