Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-HIP-55, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191989

Catalog No. NBP191989


Add to cart

Description

Description

HIP-55 Polyclonal antibody specifically detects HIP-55 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

HIP-55
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
ABP1, Cervical SH3P7, CMAP, Drebrin-F, drebrin-like, drebrin-like protein, HIP-55SH3P7Cervical mucin-associated protein, HPK1-interacting protein of 55 kDa, SH3 domain-containing protein 7, src homology 3 domain-containing protein HIP-55
Rabbit
IgG
0.1 ml
Signal Transduction
Primary
28988
Human, Mouse, Rat
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Affinity Purified
DBNL
This antibody was developed against Recombinant Protein corresponding to amino acids:PPEQETFYEQPPLVQQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGH
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of human HIP-55 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only