Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HIP-55 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP191989
Description
HIP-55 Polyclonal specifically detects HIP-55 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
HIP-55 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
ABP1, Cervical SH3P7, CMAP, Drebrin-F, drebrin-like, drebrin-like protein, HIP-55SH3P7Cervical mucin-associated protein, HPK1-interacting protein of 55 kDa, SH3 domain-containing protein 7, src homology 3 domain-containing protein HIP-55 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of human HIP-55 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
DBNL | |
This antibody was developed against Recombinant Protein corresponding to amino acids:PPEQETFYEQPPLVQQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGH | |
0.1 mL | |
Signal Transduction | |
28988 | |
Human, Mouse, Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction