homeodomain interacting protein kinase 1, Mouse, Clone: 4E1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant HIPK1.

Supplier:  Abnova Corporation H00204851M07

Catalog No. 89-001-407

Description

The protein encoded by this gene belongs to the Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms. [provided by RefSeq

Sequence: CTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVALHNSVQPTAMIPEAMGSGQQLADWRNAHSHGNQYS

Specifications

• Antigen: homeodomain interacting protein kinase 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC028408
• Gene Symbols: HIPK1
• Immunogen: HIPK1 (AAH28408, 330 a.a. ∼ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 4E1
• Description: Mouse monoclonal antibody raised against a partial recombinant HIPK1.
• Gene: HIPK1
• Gene Alias: KIAA0630/MGC26642/MGC33446/MGC33548/Myak/Nbak2
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 204851
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ