Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001407

homeodomain interacting protein kinase 1, Mouse, Clone: 4E1, Abnova™

Catalog No. 89001407 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-407 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-407 Supplier Abnova Corporation Supplier No. H00204851M07
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant HIPK1.

The protein encoded by this gene belongs to the Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms. [provided by RefSeq

Sequence: CTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVALHNSVQPTAMIPEAMGSGQQLADWRNAHSHGNQYS

Specifications

Antigen homeodomain interacting protein kinase 1
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 4E1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant HIPK1.
Formulation PBS with no preservative; pH 7.4
Gene HIPK1
Gene Accession No. BC028408
Gene Alias KIAA0630/MGC26642/MGC33446/MGC33548/Myak/Nbak2
Gene Symbols HIPK1
Host Species Mouse
Immunogen HIPK1 (AAH28408, 330 a.a. ∼ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 204851
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.