Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001259

homeodomain interacting protein kinase 2, Mouse, Clone: 1F10, Abnova™

Catalog No. 89001259 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-259 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-259 Supplier Abnova Corporation Supplier No. H00028996M03
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant HIPK2.

HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors.[supplied by OMIM

Sequence: TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT

Specifications

Antigen homeodomain interacting protein kinase 2
Applications ELISA, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 1F10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant HIPK2.
Formulation PBS with no preservative; pH 7.4
Gene HIPK2
Gene Accession No. AF208291
Gene Alias DKFZp686K02111/FLJ23711/PRO0593
Gene Symbols HIPK2
Host Species Mouse
Immunogen HIPK2 (AAG41236.1, 961 a.a. ∼ 1065 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Apoptosis
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 28996
Target Species Human, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.