major histocompatibility complex, class I, C, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-016-815	50 μg

Catalog No. 89-016-815 Supplier Abnova Corporation Supplier No. H00003107B01P

Description

Mouse polyclonal antibody raised against a full-length human HLA-C protein.

HLA-C belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Over one hundred HLA-C alleles have been described [provided by RefSeq

Sequence: MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGGKGGSCSQAASSNSAQGSDESLIACKA

Specifications

• Antigen: major histocompatibility complex, class I, C
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human HLA-C protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HLA-C
• Gene Accession No.: BC002463
• Gene Alias: D6S204/FLJ27082/HLA-Cw/HLA-Cw12/HLA-JY3/HLC-C/PSORS1
• Gene Symbols: HLA-C
• Host Species: Mouse
• Immunogen: HLA-C (AAH02463, 1 a.a. ∼ 366 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 50 μg
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Gene ID (Entrez): 3107
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG