HLA-DQA1, Mouse, Clone: 1A3, Abnova™

Catalog No.	Quantity
89-123-157	100 μg

Catalog No. 89-123-157 Supplier Abnova Corporation Supplier No. H00003117M01

Description

Mouse monoclonal antibody raised against a partial recombinant HLA-DQA1.

HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. [provided by RefSeq

Sequence: EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEEFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATN

Specifications

• Antigen: HLA-DQA1
• Applications: ELISA, In situ PLA, Western Blot
• Classification: Monoclonal
• Clone: 1A3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant HLA-DQA1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HLA-DQA1
• Gene Accession No.: NM_002122
• Gene Alias: CD/CELIAC1/DQ-A1/FLJ27088/FLJ27328/GSE/HLA-DQA/MGC149527
• Gene Symbols: HLA-DQA1
• Host Species: Mouse
• Immunogen: HLA-DQA1 (NP_002113.2,24 a.a. ∽ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Unpurified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3117
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ