high mobility group AT-hook 2, Mouse, Clone: 2D10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant HMGA2.

Supplier:  Abnova Corporation H00008091M01

Catalog No. 89-014-218

Description

This gene encodes a protein that belongs to the nonhistone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKP

Specifications

• Antigen: high mobility group AT-hook 2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1X PBS, pH 7.4
• Gene Accession No.: NM_003483
• Gene Symbols: HMGA2
• Immunogen: HMGA2 (NP_003474, 1 a.a. ∼ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG1 κ

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 2D10
• Description: Mouse monoclonal antibody raised against a partial recombinant HMGA2.
• Gene: HMGA2
• Gene Alias: BABL/HMGI-C/HMGIC/LIPO/STQTL9
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8091
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.