high-mobility group box 2, Mouse, Clone: 3D2, Abnova™

Catalog No.	Quantity
89-000-718	100 μg

Catalog No. 89-000-718 Supplier Abnova Corporation Supplier No. H00003148M04

Description

Mouse monoclonal antibody raised against a full-length recombinant HMGB2.

This gene encodes a member of the nonhistone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. [provided by RefSeq

Sequence: MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE

Specifications

• Antigen: high-mobility group box 2
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 3D2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant HMGB2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HMGB2
• Gene Accession No.: BC000903
• Gene Alias: HMG2
• Gene Symbols: HMGB2
• Host Species: Mouse
• Immunogen: HMGB2 (AAH00903.2, 1 a.a. ∼ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3148
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ