hook homolog 1 (Drosophila) (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-629	50 μL

Catalog No. 89-004-629 Supplier Abnova Corporation Supplier No. H00051361A01

Description

Mouse polyclonal antibody raised against a partial recombinant HOOK1.

This gene encodes a member of the hook family of coiled-coil proteins, which bind to microtubules and organelles through their N- and C-terminal domains, respectively. The encoded protein localizes to discrete punctuate subcellular structures, and interacts with several members of the Rab GTPase family involved in endocytosis. It is thought to link endocytic membrane trafficking to the microtubule cytoskeleton. Several alternatively spliced transcript variants have been identified, but the full-length nature of some of these variants has not been determined. [provided by RefSeq

Sequence: MLLRKQLAEKERRIEILESECKVAKFRDYEEKLIVSAWYNKSLAFQKLGMESRLVSGGGACSDTGACTPARSFLAQQRHITNTRRNLSVKVPATTSD

Specifications

• Antigen: hook homolog 1 (Drosophila)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HOOK1.
• Formulation: 50% glycerol
• Gene: HOOK1
• Gene Accession No.: NM_015888
• Gene Alias: HK1/MGC10642
• Gene Symbols: HOOK1
• Host Species: Mouse
• Immunogen: HOOK1 (NP_056972, 632 a.a. ∼ 728 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 51361
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum