homeobox A1, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human HOXA1 protein.

Supplier:  Abnova Corporation H00003198B01P

Catalog No. 89-016-819

Description

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region. [provided by RefSeq

Sequence: MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH

Specifications

• Antigen: homeobox A1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human HOXA1 protein.
• Gene: HOXA1
• Gene Alias: BSAS/HOX1/HOX1F/MGC45232
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Immunofluorescence, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_005522.4
• Gene Symbols: HOXA1
• Immunogen: HOXA1 (NP_005513.1, 1 a.a. ∼ 335 a.a) full-length human protein.
• Quantity: 50 μg
• Research Discipline: Transcription Regulation
• Gene ID (Entrez): 3198
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG