homeobox A11, Mouse, Clone: 8B8, Abnova™

Catalog No.	Quantity
89-000-724	100 μg

Catalog No. 89-000-724 Supplier Abnova Corporation Supplier No. H00003207M05

Description

Mouse monoclonal antibody raised against a partial recombinant HOXA11.

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is involved in the regulation of uterine development and is required for female fertility. Mutations in this gene can cause radio-ulnar synostosis with amegakaryocytic thrombocytopenia. [provided by RefSeq

Sequence: VTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQFFETAYGTPENLASSDYPGDKSAE

Specifications

• Antigen: homeobox A11
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 8B8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant HOXA11.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HOXA11
• Gene Accession No.: NM_005523
• Gene Alias: HOX1/HOX1I
• Gene Symbols: HOXA11
• Host Species: Mouse
• Immunogen: HOXA11 (NP_005514, 60 a.a. ∼ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3207
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ