homeobox A4, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-151	50 μL

Catalog No. 89-004-151 Supplier Abnova Corporation Supplier No. H00003201A01

Description

Mouse polyclonal antibody raised against a partial recombinant HOXA4.

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. [provided by RefSeq

Sequence: DKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKW

Specifications

• Antigen: homeobox A4
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HOXA4.
• Formulation: 50% glycerol
• Gene: HOXA4
• Gene Accession No.: NM_002141
• Gene Alias: HOX1/HOX1D
• Gene Symbols: HOXA4
• Host Species: Mouse
• Immunogen: HOXA4 (NP_002132, 181 a.a. ∼ 270 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3201
• Target Species: Human, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum