Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000725

homeobox B1, Mouse, Clone: 3F9, Abnova™

Catalog No. 89000725 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-725 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-725 Supplier Abnova Corporation Supplier No. H00003211M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant HOXB1.

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. [provided by RefSeq

Sequence: MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGV

Specifications

Antigen homeobox B1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3F9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant HOXB1.
Formulation PBS with no preservative; pH 7.4
Gene HOXB1
Gene Accession No. NM_002144
Gene Alias HOX2/HOX2I/Hox-2.9/MGC116843/MGC116844/MGC116845
Gene Symbols HOXB1
Host Species Mouse
Immunogen HOXB1 (NP_002135, 1 a.a. ∼ 74 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 3211
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.