Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

homeobox B9, Mouse, Clone: 3C8, Abnova™

Catalog No. 89000728 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-728 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-728 Supplier Abnova Corporation Supplier No. H00003219M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant HOXB9.

This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer. [provided by RefSeq

Sequence: PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEG

Specifications

Antigen homeobox B9
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3C8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant HOXB9.
Formulation PBS with no preservative; pH 7.4
Gene HOXB9
Gene Accession No. NM_024017
Gene Alias HOX-2.5/HOX2/HOX2E
Gene Symbols HOXB9
Host Species Mouse
Immunogen HOXB9 (NP_076922.1, 65 a.a. ∼ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 3219
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.