homeobox C10, Mouse, Clone: 3F10, Abnova™

Catalog No.	Quantity
89-000-730	100 μg

Catalog No. 89-000-730 Supplier Abnova Corporation Supplier No. H00003226M02

Description

Mouse monoclonal antibody raised against a partial recombinant HOXC10.

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation. [provided by RefSeq

Sequence: LDKTPHCSGANDFEAPFEQRASLNPRAEHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLAGPKGSPSESEKERAKAADSSPDTSDNEAKEEIKAEN

Specifications

• Antigen: homeobox C10
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3F10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant HOXC10.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HOXC10
• Gene Accession No.: BC001293
• Gene Alias: HOX3I/MGC5259
• Gene Symbols: HOXC10
• Host Species: Mouse
• Immunogen: HOXC10 (AAH01293, 158 a.a. ∼ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3226
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ