Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

homeobox C10, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant HOXC10.

Manufacturer:  Abnova Corporation H00003226A02

Catalog No. 89-004-153



Description

Description

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation. [provided by RefSeq

Sequence: LDKTPHCSGANDFEAPFEQRASLNPRAEHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLAGPKGSPSESEKERAKAADSSPDTSDNEAKEEIKAEN
Specifications

Specifications

homeobox C10
Unconjugated
50% glycerol
BC001293
HOX3I|MGC5259
Mouse
50 uL
Cell Cycle
Y
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant HOXC10.
HOXC10
Serum
HOXC10
HOXC10 (AAH01293, 158 a.a. ~ 257 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
3226
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit