Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

homeobox D1 (A01), Mouse anti-Human, Rat, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant HOXD1.

Manufacturer:  Abnova Corporation H00003231A01

Catalog No. 89-004-154


Add to cart

Description

Description

This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior-posterior (a-p) limb axis. [provided by RefSeq

Sequence: QVDYAAFGEPGPFPACLKASADGHPGAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ
Specifications

Specifications

homeobox D1
Unconjugated
50% glycerol
NM_024501
HOX4|HOX4G|Hox-4.7
Mouse
50 uL
Transcription Regulation
Y
Polyclonal
Human, Rat
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant HOXD1.
HOXD1
Serum
HOXD1
HOXD1 (NP_078777, 151 a.a. ~ 240 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
3231
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit