hepsin, Mouse, Clone: 2D5, Abnova™

Catalog No.	Quantity
89-000-734	100 μg

Catalog No. 89-000-734 Supplier Abnova Corporation Supplier No. H00003249M02

Description

Mouse monoclonal antibody raised against a full-length recombinant HPN.

This gene encodes a type II transmembrane serine protease. The encoded protein has an extracellular region that consists of two domains, a catalytic serine protease domain and a noncatalytic scavenger receptor cysteine-rich domain. This protein may be involved in diverse cellular functions including blood coagulation, maintenance of cell morphology and the growth and progression of certain cancers, particularly prostate cancer. Alternative splicing results in multiple transcript variants

Sequence: VAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFACEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL

Specifications

• Antigen: hepsin
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2D5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant HPN.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HPN
• Gene Accession No.: BC025716
• Gene Alias: TMPRSS1
• Gene Symbols: HPN
• Host Species: Mouse
• Immunogen: HPN (AAH25716.1, 40 a.a. ∼ 417 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3249
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ