heparan sulfate 2-O-sulfotransferase 1 (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-006-826	50 μL

Catalog No. 89-006-826 Supplier Abnova Corporation Supplier No. H00009653B01

Description

Mouse polyclonal antibody raised against a full-length human HS2ST1 protein.

Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Two alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq

Sequence: MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW

Specifications

• Antigen: heparan sulfate 2-O-sulfotransferase 1
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human HS2ST1 protein.
• Formulation: No additive
• Gene: HS2ST1
• Gene Accession No.: BC025990.1
• Gene Alias: FLJ11317/KIAA0448/MGC131986/dJ604K5.2
• Gene Symbols: HS2ST1
• Host Species: Mouse
• Immunogen: HS2ST1 (AAH25990.1, 1 a.a. ∼ 229 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 9653
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum