hydroxysteroid (11-beta) dehydrogenase 1, Mouse, Clone: 2C10, Abnova™

Catalog No.	Quantity
89-001-461	200 μL

Catalog No. 89-001-461 Supplier Abnova Corporation Supplier No. H00003290M02A

Description

Mouse monoclonal antibody raised against a full-length recombinant HSD11B1.

The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK

Specifications

• Antigen: hydroxysteroid (11-beta) dehydrogenase 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2C10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant HSD11B1.
• Formulation: ascites with no preservative
• Gene: HSD11B1
• Gene Accession No.: BC012593
• Gene Alias: 11-DH/11-beta-HSD1/HDL/HSD11/HSD11B/HSD11L/MGC13539/SDR26C1
• Gene Symbols: HSD11B1
• Host Species: Mouse
• Immunogen: HSD11B1 (AAH12593, 1 a.a. ∼ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3290
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ